PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00057.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 1184aa    MW: 128190 Da    PI: 6.6104
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00057.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-2074129156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Zpz_sc00057.1.g00080.1.am.mk  74 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 129
                                   688999***********************************************998 PP

2START117.12.4e-3734852643205
                                   SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEE CS
                         START  43 dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg........galqlmvaelqalsplvp.Rdfv 110
                                    ++e +r+s+vv+m++ +lv  +l+ + +W e ++    ka +++vis g        g l lm+a+lq++splvp R++v
  Zpz_sc00057.1.g00080.1.am.mk 348 TRTEGSRDSAVVIMNSITLVDAFLNAN-KWMELFPsivsKARIIQVISHGaasgnmgsGSLLLMQADLQFPSPLVPiREVV 427
                                   57899**********************.**********9****************************************** PP

                                   EEEEEEE..TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHH CS
                         START 111 fvRyirq.lgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvks 187
                                   f Ry+   + +g+w ivd  v+  +      ssvv++ ++pSg++i++++ng+s+v+wveh++  g     h +++  v  
  Zpz_sc00057.1.g00080.1.am.mk 428 FFRYCVHnSDEGTWSIVDFPVEGFDLEVLqASSVVKSLRRPSGCMIQDMPNGYSRVVWVEHMEIVGEEKplHPVFKDYVAG 508
                                   *******9999**********998888888*********************************98765449********** PP

                                   HHHHHHHHHHHHTXXXXX CS
                         START 188 glaegaktwvatlqrqce 205
                                   g+a+ga +wv+ lqrqce
  Zpz_sc00057.1.g00080.1.am.mk 509 GAAFGATRWVSLLQRQCE 526
                                   *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.55E-1965132IPR009057Homeodomain-like
PROSITE profilePS5007117.0771131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-2072135IPR009057Homeodomain-like
SMARTSM003891.1E-1972135IPR001356Homeobox domain
CDDcd000861.10E-1874132No hitNo description
PfamPF000465.3E-1874129IPR001356Homeobox domain
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PROSITE profilePS5084841.339281530IPR002913START domain
SuperFamilySSF559611.14E-23284526No hitNo description
SMARTSM002345.3E-16290527IPR002913START domain
CDDcd088752.94E-91301526No hitNo description
PfamPF018522.4E-30348526IPR002913START domain
SuperFamilySSF559611.22E-10538743No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1184 aa     Download sequence    Send to blast
MGALQVSKDE EMELEMDMEL SGGSGSGHFD GLLGFADVDD DRPENKPQNG CLDIQPADGG  60
KQEQNNQLVV NGKKKRYHRH TAHQIQQMEA LFKECPHPDD KQRLKLSQEL GLKPRQVKFW  120
FQNRRTQMKA QQDRADNVLL RAENESLKGE NFRLQAAIRN VVCPNCGHAA VLGEMSFEEQ  180
QLRIENARLK EELDRLACIT TRYGGGGGWQ SSLSASGLGV STPSALLMPP VDLDMNVYSR  240
HFTYPPSIME NIPPVMALQP QISNHHAASS PYVSGLMAPV LEQDRQLVVD LAATAADALA  300
KMCRTGEPLW APRGGASAEV MVPEEHSRIF SWPVDGGKQS EASAANTTRT EGSRDSAVVI  360
MNSITLVDAF LNANKWMELF PSIVSKARII QVISHGAASG NMGSGSLLLM QADLQFPSPL  420
VPIREVVFFR YCVHNSDEGT WSIVDFPVEG FDLEVLQASS VVKSLRRPSG CMIQDMPNGY  480
SRVVWVEHME IVGEEKPLHP VFKDYVAGGA AFGATRWVSL LQRQCELIRT PEARANMMKL  540
SQRMITTFCA NISAAGSQSW TALSDCTEDT FRVATRKNND LGQPSGVILT AVSTSWLPFS  600
HQRVFELLAD EQQRCQAASN SSQNVELLLQ ESSTHPDGGS LVVFATVDVD AIQVTMSGDD  660
PSQIPLLPLG FAIFPAPNPS PAATSANSGN GESSSSGHTD EPASGCLLTV GMQVLASAVP  720
SAKLNLSSVT AINSHVCNAI HQITTALKGT GTPQAESPTA RRRVCEEESR ANQLRPHPGI  780
PGSLLLLSGF TVWLVAVAGV RLGGVHALVL PFLFLPRPSS YLNALPFCGV ASHWIPVFSR  840
FAFARDMLVS GVILVGRCLV GGGDMPLVVN EATDCVVFRA LLSSSTASPA FLCIVGSGGR  900
WCGRATVDCA LRVSGFPRRI RTYEDSRSLS PHKADDGASN DLAAWWDTED LNSSSDSCRA  960
TASMSSAQSH NSEERAWTFC CSTQSRDVLK YSARRPSISS AWSSASDLSD NNSALPGHCE  1020
VLTGRLVHEV VDRALQQFVW SQVSPRGCGL ESEFPRHPIQ KKNLLGIIRS NIALRTGHGF  1080
VPCGLRSLEP PSKPIPLWLN NHRFPSSAIA MDLCLDANIR LPLVGCLIAS ASIWLQSTVT  1140
TPPVAPSPTS DFVGSPASKE RDCLVGSWGK PLHYSLGASK LFGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983556.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_004983555.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLK4A5P80.0K4A5P8_SETIT; Uncharacterized protein
STRINGSi034202m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78463441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7